DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and CtsK2

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_725686.1 Gene:CtsK2 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster


Alignment Length:84 Identity:22/84 - (26%)
Similarity:31/84 - (36%) Gaps:12/84 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 FLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTVEEWKTKQRPN 414
            ||...|..|....:.......|......::..|..|..||.:||:.:|.::|||           
  Fly   115 FLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLT----------- 168

  Fly   415 LAPEFSKEETTTKISKEKK 433
             ..||..:.|..|.|.|.|
  Fly   169 -HSEFLSQLTGLKRSPEAK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 15/55 (27%)
CtsK2NP_725686.1 Inhibitor_I29 112..172 CDD:462410 15/68 (22%)
Peptidase_C1A 204..418 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.