DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and CG6347

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:80 Identity:25/80 - (31%)
Similarity:37/80 - (46%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 FLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTVEEWKTKQRPN 414
            ||...|..|.|| |...|.:||......|...|:..:.||..|:.|:|..:|:|.:|..|.....
  Fly    41 FLRQTGKVYSDE-ERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSK 104

  Fly   415 LAPEFSKEETTTKIS 429
            :: ||.:..|...|:
  Fly   105 IS-EFGERYTNGHIN 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 19/55 (35%)
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 19/56 (34%)
Peptidase_C1A 131..350 CDD:239068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.