Sequence 1: | NP_610907.1 | Gene: | CG6357 / 36532 | FlyBaseID: | FBgn0033875 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001029282.1 | Gene: | Ctsf / 361704 | RGDID: | 1308181 | Length: | 462 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 44/196 - (22%) |
---|---|---|---|
Similarity: | 72/196 - (36%) | Gaps: | 46/196 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 SPATQKINPEIGVTTGKSDADSSTPTIEHTSGLSEFEEECQFAWQRFLVDFDVHYDNDYERQKRR 93
Fly 94 DIFCENW---QKVRDHNLKYDLGVVSFKKGINQWSDLTFEEWKEKQTPKVMPEIASES------S 149
Fly 150 KEERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNVFCAN-WRAIVEHNVQYEKWAEPFKRDINQ 213
Fly 214 W 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6357 | NP_610907.1 | Inhibitor_I29 | 72..132 | CDD:285458 | 18/62 (29%) |
Inhibitor_I29 | 162..221 | CDD:214853 | 13/54 (24%) | ||
Inhibitor_I29 | 252..311 | CDD:214853 | |||
Inhibitor_I29 | 347..406 | CDD:214853 | |||
Ctsf | NP_001029282.1 | Inhibitor_I29 | 165..221 | CDD:214853 | 17/61 (28%) |
Peptidase_C1 | 249..460 | CDD:395062 | 13/60 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |