DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsl

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_037288.1 Gene:Ctsl / 25697 RGDID:2448 Length:334 Species:Rattus norvegicus


Alignment Length:80 Identity:24/80 - (30%)
Similarity:37/80 - (46%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 ATTKISKDKRDDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFK 393
            ||.|.      |.|..|.|.::.......|...:| |.||.::..|.:.||.||.::..|...|.
  Rat    17 ATPKF------DQTFNAQWHQWKSTHRRLYGTNEE-EWRRAVWEKNMRMIQLHNGEYSNGKHGFT 74

  Fly   394 KGINQWSDLTVEEWK 408
            ..:|.:.|:|.||::
  Rat    75 MEMNAFGDMTNEEFR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 16/58 (28%)
CtslNP_037288.1 Inhibitor_I29 29..87 CDD:214853 16/58 (28%)
Peptidase_C1 114..332 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.