DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsc

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_058793.1 Gene:Ctsc / 25423 RGDID:2445 Length:462 Species:Rattus norvegicus


Alignment Length:200 Identity:40/200 - (20%)
Similarity:62/200 - (31%) Gaps:85/200 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGVPLLLYLMGVALGVPVSTSSPATQKINP-------EIGVTTGKSDADSST--PTIE----HTS 59
            |...|||.|:||.   .||:.:||......       ::|....:|..:.|.  ||.|    |..
  Rat     8 LRAALLLVLLGVC---TVSSDTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLK 69

  Fly    60 GLSEFEEEC-------------------QFAWQRFLVDFDVHYDNDYERQKRR------------ 93
            .|....:|.                   .:.|..|.         .||.:..|            
  Rat    70 KLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFF---------KYEVKGSRAISYCHETMTGW 125

  Fly    94 --DIFCENW-----QKVRDHNLKYDLGVV------------------SFKKGIN----QWSDLTF 129
              |:...||     :|:.:|:.|..:.|.                  :|.|.||    .|:..|:
  Rat   126 VHDVLGRNWACFVGKKMANHSEKVYVNVAHLGGLQEKYSERLYSHNHNFVKAINSVQKSWTATTY 190

  Fly   130 EEWKE 134
            ||:::
  Rat   191 EEYEK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 19/100 (19%)
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
CtscNP_058793.1 CathepsinC_exc 25..138 CDD:400909 19/121 (16%)
Pox_I6 168..>204 CDD:333259 8/27 (30%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.