DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and BC051665

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_954599.2 Gene:BC051665 / 218275 MGIID:2682300 Length:330 Species:Mus musculus


Alignment Length:117 Identity:26/117 - (22%)
Similarity:39/117 - (33%) Gaps:39/117 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LGNISFKKGINQWSDLTVEEWKNKQRPAFNPEFSKVEATTKISKDKRDDNTCQAAWKKFLIDFGA 356
            ||.:|.....:...|...||||.|.|..:|                                   
Mouse    12 LGVVSAAPAHDPSLDAVWEEWKTKHRKTYN----------------------------------- 41

  Fly   357 KYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTVEEWK 408
                ..|..::|.::.:|.|.|..|||.:..|...|...:|.:.|||..|::
Mouse    42 ----MNEEAQKRAVWENNMKMIGLHNEDYLKGKHGFNLEMNAFGDLTNTEFR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 4/18 (22%)
Inhibitor_I29 347..406 CDD:214853 14/58 (24%)
BC051665NP_954599.2 Inhibitor_I29 29..87 CDD:214853 21/96 (22%)
Peptidase_C1 114..329 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.