DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Y40H7A.10

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_502836.1 Gene:Y40H7A.10 / 189809 WormBaseID:WBGene00012747 Length:343 Species:Caenorhabditis elegans


Alignment Length:144 Identity:47/144 - (32%)
Similarity:68/144 - (47%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SDADS-------STPTIEHTSGLSEFEEECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENWQKV 103
            ||.|.       .||.:::|:           |:|.|||.:...|.|:||..||..||..|...|
 Worm    29 SDLDQILQRHHIPTPDVKYTN-----------AFQNFLVKYLREYPNEYEIVKRFTIFSRNLDLV 82

  Fly   104 RDHNLKYDLGVVSFKKGINQWSDLTFEEWKE-KQTPKVMPEIASESSKEER--DKVNCQAAWEKF 165
            ..:| |.|.|.|:::  :|.:||||.||||: ..|||  |:.:.:|.|.:.  ||.|        
 Worm    83 ERYN-KEDAGKVTYE--LNDFSDLTEEEWKKYLMTPK--PDHSEKSLKPKTLIDKKN-------- 134

  Fly   166 LIDFGAQYKNANET 179
             :.....::|.|.|
 Worm   135 -LPNSVDWRNVNGT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 25/59 (42%)
Inhibitor_I29 162..221 CDD:214853 3/18 (17%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
Y40H7A.10NP_502836.1 Inhibitor_I29 51..108 CDD:462410 25/59 (42%)
Peptidase_C1A 136..336 CDD:239068 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.