DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and C32B5.7

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:220 Identity:42/220 - (19%)
Similarity:73/220 - (33%) Gaps:74/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FEEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLID-FGAQYKNAN----ETEKRRNVFCA 188
            |.:|:::..  |.|         .:|:.||.|::....|. ..:.|..||    ...:::.:.|.
 Worm    55 FLDWRDEGV--VGP---------VKDQGNCNASYAFAAISAIESMYAIANGQLLSFSEQQIIDCL 108

  Fly   189 NWRAIVEHNVQYEKWAEPFKRDINQWTDHTIEERSSPAPEIRKEEATTSTSEIDNDNIICQPAWE 253
            ...||....:....:.|  ::.|..:||:         |.:.|:.                   |
 Worm   109 GGCAIESDPMMAMTYLE--RKGIETYTDY---------PFVGKKN-------------------E 143

  Fly   254 KFLIDFKPSY--QDDT---ETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEEWK 313
            |...|.|.:|  .|||   ..|....||.|                   ::|...::..|...:.
 Worm   144 KCEYDSKKAYLILDDTYDMSDESLALVFID-------------------ERGPGLFTMNTPPSFF 189

  Fly   314 NKQRPAFNPEFSKVEATTKISKDKR 338
            |.:...:||    .|...|.:.:||
 Worm   190 NYKSGIYNP----TEEECKSTNEKR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 1/2 (50%)
Inhibitor_I29 162..221 CDD:214853 11/63 (17%)
Inhibitor_I29 252..311 CDD:214853 14/63 (22%)
Inhibitor_I29 347..406 CDD:214853
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 41/219 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.