DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and R09F10.1

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_509408.1 Gene:R09F10.1 / 181087 WormBaseID:WBGene00019986 Length:383 Species:Caenorhabditis elegans


Alignment Length:274 Identity:50/274 - (18%)
Similarity:93/274 - (33%) Gaps:99/274 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ESSKEERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNVFCANWRAIVEHNVQYEKWAEPFKRDI 211
            |:.|.|:       .:..|::.|..:|.:..|.|.|..:|..|   ::|...:.|: ......|:
 Worm    74 ENLKHEQ-------MFNDFILKFDRKYTSVEEFEYRYQIFLRN---VIEFEAEEER-NLGLDLDV 127

  Fly   212 NQWTDHTIEERSSPAPEIRKEEATTSTSEIDNDNI---ICQPAWEKFLIDFKPSYQDDTETEKRR 273
            |::||.|.||......|.:..:....|.:.:...:   :.:||    .||::             
 Worm   128 NEFTDWTDEELQKMVQENKYTKYDFDTPKFEGSYLETGVIRPA----SIDWR------------- 175

  Fly   274 NVFCDNFKSIHKHNVQFDLGNISFKKGINQ----WSDLTVEEWKNKQRPAFNPEFSKVEATTKIS 334
                             :.|.::..|...|    |:..||               :.|||...|.
 Worm   176 -----------------EQGKLTPIKNQGQCGSCWAFATV---------------ASVEAQNAIK 208

  Fly   335 KDK-------------RDDNTCQAAWK----KFLIDFGAKYQDE-------------KETEKRRT 369
            |.|             ..:|.|...::    ||:.:.|.:.:.|             ||.:.|  
 Worm   209 KGKLVSLSEQEMVDCDGRNNGCSGGYRPYAMKFVKENGLESEKEYPYSALKHDQCFLKENDTR-- 271

  Fly   370 IFCDNWKAIQEHNE 383
            :|.|:::.:..:.|
 Worm   272 VFIDDFRMLSNNEE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853 15/58 (26%)
Inhibitor_I29 252..311 CDD:214853 8/62 (13%)
Inhibitor_I29 347..406 CDD:214853 10/54 (19%)
R09F10.1NP_509408.1 Inhibitor_I29 82..138 CDD:285458 16/59 (27%)
Peptidase_C1 169..381 CDD:278538 28/168 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.