DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and F32H5.1

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_506310.1 Gene:F32H5.1 / 179815 WormBaseID:WBGene00009347 Length:356 Species:Caenorhabditis elegans


Alignment Length:330 Identity:61/330 - (18%)
Similarity:89/330 - (26%) Gaps:134/330 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KINPEIGVTTGKSDADSSTPTIEHTSGLSEFEEECQFAWQRFLVDFDVHYDNDYERQKRRDIFCE 98
            |.|.|:...||..:.                           |||....:|:   |||...  |.
 Worm    74 KSNDEVSEKTGNDNV---------------------------LVDIPSSFDS---RQKWPS--CS 106

  Fly    99 NWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEEWKEKQTPKVMPEIASE-------SSKEE---- 152
            ....|||.:   |.|..:....:...||.|.              |||.       |:::.    
 Worm   107 QIGAVRDQS---DCGSAAHLVAVEIASDRTC--------------IASNGTFNWPLSAQDPLSCC 154

  Fly   153 -------RDKVNCQAAWEKFLIDF--------GAQY----------------KNANETEKRRNVF 186
                   .|...|..:|.|.::.:        |..|                |.||.|   .:|.
 Worm   155 VGLMSICGDGWGCDGSWPKDILKWWQTHGLCTGGNYNDQFGCKPYSIYPCDKKYANGT---TSVP 216

  Fly   187 CANWR--AIVEHNVQYEKWAEPFKRDINQWTDHTIEERSSPAPEIRKEEATTSTSEIDNDNIICQ 249
            |..:.  ...||......|...:|:|.:....|.         .:.|:........:.|..:|. 
 Worm   217 CPGYHTPTCEEHCTSNITWPIAYKQDKHFGKAHY---------NVGKKMTDIQIEIMTNGPVIA- 271

  Fly   250 PAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFK-------KGINQWSDL 307
                .|:|     |.|          |.|....|:.|......|.:..|       .|:..|  |
 Worm   272 ----SFII-----YDD----------FWDYKTGIYVHTAGDQEGGMDTKIIGWGVDNGVPYW--L 315

  Fly   308 TVEEW 312
            .|.:|
 Worm   316 CVHQW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 16/59 (27%)
Inhibitor_I29 162..221 CDD:214853 16/84 (19%)
Inhibitor_I29 252..311 CDD:214853 14/65 (22%)
Inhibitor_I29 347..406 CDD:214853
F32H5.1NP_506310.1 Peptidase_C1A_CathepsinB 93..348 CDD:239111 53/284 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.