DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and cpr-9

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001369965.1 Gene:cpr-9 / 179645 WormBaseID:WBGene00010204 Length:351 Species:Caenorhabditis elegans


Alignment Length:67 Identity:15/67 - (22%)
Similarity:19/67 - (28%) Gaps:26/67 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 WKNKQRPAFNPEFSKVEATTKISKDKRDDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWK 376
            |.|      .|..||:          ||.::|.:.|.          ....||...|.....|.|
 Worm   107 WPN------CPSISKI----------RDQSSCGSCWA----------VSAAETISDRICIASNAK 145

  Fly   377 AI 378
            .|
 Worm   146 TI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 7/32 (22%)
cpr-9NP_001369965.1 Peptidase_C1A_CathepsinB 98..338 CDD:239111 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.