DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and cpr-1

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_506002.2 Gene:cpr-1 / 179637 WormBaseID:WBGene00000781 Length:329 Species:Caenorhabditis elegans


Alignment Length:174 Identity:29/174 - (16%)
Similarity:43/174 - (24%) Gaps:90/174 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 FKPSYQDDTETEKRRNVFCDNFKSIHKHNVQ--------------FDLGNISFKKGINQWSDLTV 309
            ||..:.:.||.|.:..:....:.:.|...::              ||        ...|||:   
 Worm    44 FKTEHVEITEEEMKFKLMDGKYAAAHSDEIRATEQEVVLASVPATFD--------SRTQWSE--- 97

  Fly   310 EEWKNKQRPAFNPEFSKVEATTKISKDKRDDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDN 374
                                 .|..|..||..||.:.|.     |||                  
 Worm    98 ---------------------CKSIKLIRDQATCGSCWA-----FGA------------------ 118

  Fly   375 WKAIQEHNEQFELGVESFKKGINQWSDLTVEEWKTKQRPNLAPE 418
                                 ....||.|..|.|..|:|.::|:
 Worm   119 ---------------------AEMISDRTCIETKGAQQPIISPD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 11/65 (17%)
Inhibitor_I29 347..406 CDD:214853 7/58 (12%)
cpr-1NP_506002.2 Peptidase_C1A_CathepsinB 86..325 CDD:239111 23/132 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.