DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and CTSW

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:375 Identity:75/375 - (20%)
Similarity:116/375 - (30%) Gaps:157/375 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENW---QKVRDHNLKYDLGVVSFKKGINQWSDLT 128
            |.:.|::.|.:.|:..|.:..|...|.|||..|.   |::::.    |||...|  |:..:||||
Human    37 ELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEE----DLGTAEF--GVTPFSDLT 95

  Fly   129 FEEWKEKQ--------TPKVMPEIASESSKEE-----------------RDKVNCQAAWE----- 163
            .||:.:..        .|.:..||.||..:|.                 :|:.||...|.     
Human    96 EEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASAISPIKDQKNCNCCWAMAAAG 160

  Fly   164 ------------------KFLIDFG----------------AQYKNANETEKRRNVFCANWRAIV 194
                              :.|:|.|                ....|:....::...|....||..
Human   161 NIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHR 225

  Fly   195 EHNVQYEK--WAEPFKRDINQWTDH------------TIEERSSPAPEIRKE--EATTSTSEIDN 243
            .|..:|:|  |.:.|  .:.|..:|            |:.....|....||.  :||.:|     
Human   226 CHPKKYQKVAWIQDF--IMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTT----- 283

  Fly   244 DNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQF-DLGNISFKKGINQWSDL 307
                |.|.    |:|                           |:|.. ..|::..::||  |:: 
Human   284 ----CDPQ----LVD---------------------------HSVLLVGFGSVKSEEGI--WAE- 310

  Fly   308 TVEEWKNKQRPAFNPEFSKVEATTKISKDK--------------RDDNTC 343
            ||......|.|...|.:        |.|:.              |..|||
Human   311 TVSSQSQPQPPHPTPYW--------ILKNSWGAQWGEKGYFRLHRGSNTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 20/62 (32%)
Inhibitor_I29 162..221 CDD:214853 16/111 (14%)
Inhibitor_I29 252..311 CDD:214853 10/59 (17%)
Inhibitor_I29 347..406 CDD:214853
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 19/61 (31%)
Peptidase_C1A 129..358 CDD:239068 46/277 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.