DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6357 and CTSS

DIOPT Version :9

Sequence 1:	NP_610907.1	Gene:	CG6357 / 36532	FlyBaseID:	FBgn0033875	Length:	439	Species:	Drosophila melanogaster
Sequence 2:	NP_004070.3	Gene:	CTSS / 1520	HGNCID:	2545	Length:	331	Species:	Homo sapiens

Alignment Length:	103	Identity:	29/103 - (28%)
Similarity:	46/103 - (44%)	Gaps:	21/103 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 ATTKISKDKRDDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFK 393
            |..::.||...|:... .|||   .:|.:|:::.|...||.|:..|.|.:..||.:..:|:.|:.
Human    14 AVAQLHKDPTLDHHWH-LWKK---TYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYD 74

  Fly   394 KGINQWSDLTVEE-------------WKT----KQRPN 414
            .|:|...|:|.||             |:.    |..||
Human    75 LGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPN 112

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6357	NP_610907.1	Inhibitor_I29	72..132	CDD:285458
		Inhibitor_I29	162..221	CDD:214853
		Inhibitor_I29	252..311	CDD:214853
		Inhibitor_I29	347..406	CDD:214853	19/58 (33%)
CTSS	NP_004070.3	PTZ00203	5..326	CDD:185513	29/103 (28%)
		Inhibitor_I29	28..87	CDD:214853	19/62 (31%)
		Peptidase_C1	115..329	CDD:278538
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	43	1.000	Domainoid score	I12369
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR12411
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.910