DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and CTSH

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:270 Identity:59/270 - (21%)
Similarity:94/270 - (34%) Gaps:90/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEE------WKEKQTPKVMPEIAS 146
            |...|...|..||:|:..||    .|..:||..:||:||::|.|      |.|.|          
Human    50 EYHHRLQTFASNWRKINAHN----NGNHTFKMALNQFSDMSFAEIKHKYLWSEPQ---------- 100

  Fly   147 ESSKEERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNVFCANWRAIVEHNVQYEKWAEPFKRDI 211
                      ||.|....:|...| .|..:.:..|:.|                  :..|.|   
Human   101 ----------NCSATKSNYLRGTG-PYPPSVDWRKKGN------------------FVSPVK--- 133

  Fly   212 NQ------WTDHT---IEERSSPAP----EIRKEEATTSTSEIDNDNIICQ-----PAWEKFLID 258
            ||      ||..|   :|...:.|.    .:.:::......:.:|..  ||     .|:|..|.:
Human   134 NQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG--CQGGLPSQAFEYILYN 196

  Fly   259 FKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGN-ISFKKGINQWSDLTV--EEWKNKQRPAF 320
             |....:||...:.::.:|           :|..|. |.|.|.:   :::|:  ||...:....:
Human   197 -KGIMGEDTYPYQGKDGYC-----------KFQPGKAIGFVKDV---ANITIYDEEAMVEAVALY 246

  Fly   321 NPEFSKVEAT 330
            ||.....|.|
Human   247 NPVSFAFEVT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 17/49 (35%)
Inhibitor_I29 162..221 CDD:214853 12/67 (18%)
Inhibitor_I29 252..311 CDD:214853 12/61 (20%)
Inhibitor_I29 347..406 CDD:214853
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 16/43 (37%)
Peptidase_C1 117..332 CDD:278538 33/178 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.