DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsw

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_034115.2 Gene:Ctsw / 13041 MGIID:1338045 Length:371 Species:Mus musculus


Alignment Length:184 Identity:39/184 - (21%)
Similarity:66/184 - (35%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 TDHTIEERSSPAPEIRKEEATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDN 279
            :|..:.:.:.|.|...||                  .::.|.|.|..||.:..|..:|.::|..|
Mouse    21 SDSLLTKDAGPRPLELKE------------------VFKLFQIRFNRSYWNPAEYTRRLSIFAHN 67

  Fly   280 FKSIHKHNVQFDLGNISFKKGINQWSDLTVEE----WKNKQRPAFNPEFS-KVEATT-------- 331
            .....:.. |.|||...|  |...:||||.||    :..::.|...|..: |||:.|        
Mouse    68 LAQAQRLQ-QEDLGTAEF--GETPFSDLTEEEFGQLYGQERSPERTPNMTKKVESNTWGESVPRT 129

  Fly   332 -------KISKDKRDDNTCQAAWKKFLID-----FGAKYQDEKETEKRRTIFCD 373
                   .|....::..:|:..|.....|     :..|:|...:...:..:.|:
Mouse   130 CDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853 1/5 (20%)
Inhibitor_I29 252..311 CDD:214853 19/58 (33%)
Inhibitor_I29 347..406 CDD:214853 5/32 (16%)
CtswNP_034115.2 Inhibitor_I29 40..96 CDD:214853 19/58 (33%)
Peptidase_C1 126..356 CDD:278538 7/58 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.