DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsh

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_031827.2 Gene:Ctsh / 13036 MGIID:107285 Length:333 Species:Mus musculus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:43/104 - (41%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEE------WKEKQTPKVMPEIAS 146
            |...|..:|..||:|::.||.:..    :||..:||:||::|.|      |.|.|          
Mouse    48 EYNHRLQMFANNWRKIQAHNQRNH----TFKMALNQFSDMSFAEIKHKFLWSEPQ---------- 98

  Fly   147 ESSKEERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNV 185
                      ||.|....:|...| .|.::.:..|:.||
Mouse    99 ----------NCSATKSNYLRGTG-PYPSSMDWRKKGNV 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 16/49 (33%)
Inhibitor_I29 162..221 CDD:214853 6/24 (25%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
CtshNP_031827.2 Inhibitor_I29 33..88 CDD:462410 15/43 (35%)
Peptidase_C1A 115..329 CDD:239068 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.