DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsb

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_031824.1 Gene:Ctsb / 13030 MGIID:88561 Length:339 Species:Mus musculus


Alignment Length:280 Identity:52/280 - (18%)
Similarity:75/280 - (26%) Gaps:129/280 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GVVSFKKGINQWSDL--TF---EEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLIDFGAQ 172
            |.|:|.:.|    ||  ||   |:|..      .|.|.     :.||:.:|.:.|.     |||.
Mouse    70 GRVAFGEDI----DLPETFDAREQWSN------CPTIG-----QIRDQGSCGSCWA-----FGAV 114

  Fly   173 YKNANETEKRRNVFCANWRAIVEHNVQ-----------------YEKWAEPFKRDINQWT----- 215
                 |....|.....|.|..||.:.:                 |...|..|      ||     
Mouse   115 -----EAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSF------WTKKGLV 168

  Fly   216 -------------------DHTIEERSSPAPEIRKEEATTSTSEIDNDNIICQPAWEKFLIDFKP 261
                               :|.:.....|.         |...:....|..|:..       :.|
Mouse   169 SGGVYNSHVGCLPYTIPPCEHHVNGSRPPC---------TGEGDTPRCNKSCEAG-------YSP 217

  Fly   262 SYQDDTE------------------------TEKRRNVFCD--NFKS-IHKHNVQFDLGNISFK- 298
            ||::|..                        .|....||.|  .:|| ::||.....:|..:.: 
Mouse   218 SYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRI 282

  Fly   299 ------KGINQWSDLTVEEW 312
                  .|:..|  |....|
Mouse   283 LGWGVENGVPYW--LAANSW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 9/23 (39%)
Inhibitor_I29 162..221 CDD:214853 16/99 (16%)
Inhibitor_I29 252..311 CDD:214853 16/92 (17%)
Inhibitor_I29 347..406 CDD:214853
CtsbNP_031824.1 Propeptide_C1 26..65 CDD:285358
Peptidase_C1A_CathepsinB 81..328 CDD:239111 46/265 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.