DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Cts3

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_081182.2 Gene:Cts3 / 117066 MGIID:2151929 Length:332 Species:Mus musculus


Alignment Length:94 Identity:28/94 - (29%)
Similarity:47/94 - (50%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SKDKRDDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQ 398
            |.....|....|.|:|:.|.:|..|..|:|.:| |.::.:|.|.|:.||.:..||...|...:|.
Mouse    16 SSSPSPDPILDAEWQKWKIKYGKTYSLEEEGQK-RAVWEENMKKIKLHNGENGLGKHGFTMEMNA 79

  Fly   399 WSDLTVEEWKTKQRPNLAPEFSKEETTTK 427
            :.|:|:||::.:......|...|.::..|
Mouse    80 FGDMTLEEFRKEMIEIPVPTVKKGKSVQK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 20/58 (34%)
Cts3NP_081182.2 Inhibitor_I29 29..87 CDD:214853 20/58 (34%)
Peptidase_C1A 115..330 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.