powered by:
Protein Alignment CG6357 and Tpbpb
DIOPT Version :9
Sequence 1: | NP_610907.1 |
Gene: | CG6357 / 36532 |
FlyBaseID: | FBgn0033875 |
Length: | 439 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080705.1 |
Gene: | Tpbpb / 116913 |
MGIID: | 2151721 |
Length: | 121 |
Species: | Mus musculus |
Alignment Length: | 44 |
Identity: | 11/44 - (25%) |
Similarity: | 24/44 - (54%) |
Gaps: | 5/44 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 VMPEIASESS-KEERDKVNC-QAAWEKFLIDFGAQYKNANETEK 181
::||...::. :|::||... :|.|.:|::... .:.|:.||
Mouse 19 IIPEPTLDTEVQEQKDKEGLKKATWNEFVMKLN---NSKNDQEK 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.870 |
|
Return to query results.
Submit another query.