DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctss.3

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_017952033.2 Gene:ctss.3 / 105948322 XenbaseID:XB-GENE-29089987 Length:337 Species:Xenopus tropicalis


Alignment Length:68 Identity:22/68 - (32%)
Similarity:39/68 - (57%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 DNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTV 404
            |.|....|:.::......|:|.:|...||||:.:..|.|..||.::.||:.:::.|:|...|:||
 Frog    23 DPTLDTHWQLWVKTHQKTYKDAEEERARRTIWEETLKFITVHNLEYSLGLHTYEVGMNHLGDMTV 87

  Fly   405 EEW 407
            :|:
 Frog    88 DEF 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 19/58 (33%)
ctss.3XP_017952033.2 Inhibitor_I29 30..89 CDD:214853 19/58 (33%)
Peptidase_C1A 120..335 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.