DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and si:dkey-26g8.4

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_003199634.1 Gene:si:dkey-26g8.4 / 100537665 ZFINID:ZDB-GENE-121214-36 Length:335 Species:Danio rerio


Alignment Length:134 Identity:37/134 - (27%)
Similarity:57/134 - (42%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFK 298
            |..:.|.||   |.....|..:......||.:|.|. .||.::.:|.:.|.:||.::..||.:||
Zfish    13 AVFAASSID---IQLDDHWNSWKSQHGKSYHEDVEV-GRRMIWEENLRKIEQHNFEYSYGNHTFK 73

  Fly   299 KGINQWSDLTVEEW------------KNKQRPAF-NPEFSKVEATTKISKDKR-------DDNTC 343
            .|:||:.|:|.||:            :..|.|.| .|.|  ..|..::...:|       |...|
Zfish    74 MGMNQFGDMTNEEFRQAMNGYKHDPNRTSQGPLFMEPSF--FAAPQQVDWRQRGYVTPVKDQKQC 136

  Fly   344 QAAW 347
            .:.|
Zfish   137 GSCW 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 20/58 (34%)
Inhibitor_I29 347..406 CDD:214853 1/1 (100%)
si:dkey-26g8.4XP_003199634.1 Inhibitor_I29 28..86 CDD:214853 20/58 (34%)
Peptidase_C1 115..334 CDD:278538 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.