DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and zgc:174154

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001314908.1 Gene:zgc:174154 / 100537591 ZFINID:ZDB-GENE-071004-116 Length:335 Species:Danio rerio


Alignment Length:114 Identity:33/114 - (28%)
Similarity:52/114 - (45%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 WEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEEWKN-- 314
            |..:......||.:|.|. .||.::.:|.:.|.:||.::..||.:||.|:||:.|:|.||::.  
Zfish    28 WNSWKSQHGKSYHEDVEV-GRRMIWEENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRQAM 91

  Fly   315 ---KQRP------AFNPEFSKVEATTKISKDKR-------DDNTCQAAW 347
               ||.|      |...|.|...|..::...:|       |...|.:.|
Zfish    92 NGYKQDPNRTSKGALFMEPSFFAAPQQVDWRQRGYVTPVKDQKQCGSCW 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 20/58 (34%)
Inhibitor_I29 347..406 CDD:214853 1/1 (100%)
zgc:174154NP_001314908.1 Inhibitor_I29 28..86 CDD:214853 20/58 (34%)
Peptidase_C1 115..334 CDD:425470 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.