DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctslb.4

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001412028.1 Gene:ctslb.4 / 100536033 ZFINID:ZDB-GENE-230919-1 Length:336 Species:Danio rerio


Alignment Length:134 Identity:37/134 - (27%)
Similarity:58/134 - (43%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFK 298
            |..:.|.||   |.....|..:......||.:|.|. .||.::.:|.:.|.:||.::..||.:||
Zfish    13 AVFAASSID---IQLDDHWNSWKSQHGKSYHEDVEV-GRRMIWEENLRKIEQHNFEYSYGNHTFK 73

  Fly   299 KGINQWSDLTVEEWKN------------KQRPAF-NPEFSKVEATTKISKDKR-------DDNTC 343
            .|:||:.|:|.||:::            .|.|.| .|.|  ..|..::...:|       |...|
Zfish    74 MGMNQFGDMTNEEFRHAMNGYKHDPNQTSQGPLFMEPSF--FAAPQQVDWRQRGYVTPVKDQKQC 136

  Fly   344 QAAW 347
            .:.|
Zfish   137 GSCW 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 20/58 (34%)
Inhibitor_I29 347..406 CDD:214853 1/1 (100%)
ctslb.4NP_001412028.1 Inhibitor_I29 28..86 CDD:214853 20/58 (34%)
Peptidase_C1 115..335 CDD:425470 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.