DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CTSF

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_003784.2 Gene:CTSF / 8722 HGNCID:2531 Length:484 Species:Homo sapiens


Alignment Length:374 Identity:102/374 - (27%)
Similarity:172/374 - (45%) Gaps:65/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLGLALLGAVSL----QQLQSFPKLCDVQN---------------FDDFLRQTGKVY-SDEERVY 56
            |.|.|::.::|.    .:.::|..:..:.|               |.:|:....:.| |.||..:
Human   142 TQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARW 206

  Fly    57 RESIFAAKMSLITLSNKNA-DNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFV 120
            |.|:|...|  :......| |.|.:.:  ||...:|:|.:|..|:               ::|.:
Human   207 RLSVFVNNM--VRAQKIQALDRGTAQY--GVTKFSDLTEEEFRTI---------------YLNTL 252

  Fly   121 TARNPASAN---------LPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLA 176
            ..:.|.:..         .|..:|||.||.||....||: ||:||:|:.||.:||..|...|.|.
Human   253 LRKEPGNKMKQAKSVGDLAPPEWDWRSKGAVTKVKDQGM-CGSCWAFSVTGNVEGQWFLNQGTLL 316

  Fly   177 SLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRD-HGVTLANKYPYTQTEMQCRQNETAGRPPRES 240
            |||:|.|:||  |..:..|.||.....:..|:: .|:...:.|.|......|  |.:|    .::
Human   317 SLSEQELLDC--DKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSC--NFSA----EKA 373

  Fly   241 LVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEE--CNQGELNHSVTV 303
            .|.|.|...::. :|:|:...:|..||::.::||..:.|  |..||.....  |:...::|:|.:
Human   374 KVYINDSVELSQ-NEQKLAAWLAKRGPISVAINAFGMQF--YRHGISRPLRPLCSPWLIDHAVLL 435

  Fly   304 VGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPIL 352
            ||||..:...:|.||||:..:|||.|:..:.|.:|. ||:.:..|..::
Human   436 VGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGA-CGVNTMASSAVV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 17/60 (28%)
Peptidase_C1A 131..350 CDD:239068 75/221 (34%)
CTSFNP_003784.2 Inhibitor_I29 187..243 CDD:214853 17/59 (29%)
Peptidase_C1 271..482 CDD:278538 75/223 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.