DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT1G03720

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_171868.1 Gene:AT1G03720 / 839426 AraportID:AT1G03720 Length:274 Species:Arabidopsis thaliana


Alignment Length:259 Identity:52/259 - (20%)
Similarity:90/259 - (34%) Gaps:103/259 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 REKGGVTPPGFQ----GV-------GCGA-----CWSFATTGALEGHLFRRTGVLASLSQQNLVD 185
            ::||....|..|    ||       .|.:     ||:.|.|..|:        |:.:::|     
plant    40 KKKGPTITPVTQTDDNGVRSKLCYLNCNSYKIEICWAIALTRLLQ--------VIYNITQ----- 91

  Fly   186 CADDYGNMGCDGGFQEYGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPR------------ 238
                               |||...     .::.:....:..:..:|.|:.|.            
plant    92 -------------------EYIAGR-----LRFDHDDLVVHLKMKKTRGKRPGSMKLKNLKDAIN 132

  Fly   239 ----ESLVKIRDYATITPGD----------EEK--MKEVIAT---LGPLA--------------C 270
                :.|:|.|:..:....|          .||  .|:.|.:   :.|:|              .
plant   133 HIAVKGLLKKRESKSKAGSDIGHHTKWNFSMEKCPSKDFIKSKVDISPVAIAFDITHNFQFIGNV 197

  Fly   271 SMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYG-TENGRDYWIIKNSYSQNWGEGGFMRI 333
            |..::.:|....||...||.:..    .|.|.:|||| |:..:.:::|:||:.::||..||.||
plant   198 SKKSNGLSIYNVSGVDMEDGDAG----GHVVLIVGYGYTKENKLFFLIQNSWGEDWGVKGFGRI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 52/259 (20%)
AT1G03720NP_171868.1 Peptidase_C1 57..261 CDD:239110 47/242 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.