DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and XBCP3

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_563855.1 Gene:XBCP3 / 837517 AraportID:AT1G09850 Length:437 Species:Arabidopsis thaliana


Alignment Length:371 Identity:129/371 - (34%)
Similarity:190/371 - (51%) Gaps:58/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRMCSTMWLQMTLGLALLGAVSLQQLQSFPKLCDVQN-FDDFLRQTGKVY-SDEERVYRESIFAA 63
            |.|.|:.::.:|....||       :.|.....|:.. |||:.::.||.| |:|||..|..||..
plant     1 MSMSSSSFISLTFFFLLL-------VSSSSSSDDISELFDDWCQKHGKTYGSEEERQQRIQIFKD 58

  Fly    64 KMSLITLSN--KNADNGVSGFRLGVNTLADMTRKEI------------ATLLGSKISEFGERYTN 114
            ....:|..|  .||.     :.|.:|..||:|..|.            :.::.||....|     
plant    59 NHDFVTQHNLITNAT-----YSLSLNAFADLTHHEFKASRLGLSVSAPSVIMASKGQSLG----- 113

  Fly   115 GHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLS 179
                       .|..:|:..|||:||.||....|| .|||||||:.|||:||.....||.|.|||
plant   114 -----------GSVKVPDSVDWRKKGAVTNVKDQG-SCGACWSFSATGAMEGINQIVTGDLISLS 166

  Fly   180 QQNLVDCADDYGNMGCDGGFQEYGFEY-IRDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVK 243
            :|.|:||...| |.||:||..:|.||: |::||:.....|||.:.:..|::::.     ::.:|.
plant   167 EQELIDCDKSY-NAGCNGGLMDYAFEFVIKNHGIDTEKDYPYQERDGTCKKDKL-----KQKVVT 225

  Fly   244 IRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGT 308
            |..||.:...||:.:.|.:|. .|::..:.....:|:.||.||:.. .|:. .|:|:|.:||||:
plant   226 IDSYAGVKSNDEKALMEAVAA-QPVSVGICGSERAFQLYSSGIFSG-PCST-SLDHAVLIVGYGS 287

  Fly   309 ENGRDYWIIKNSYSQNWGEGGFMRILR---NAGGFCGIASECSYPI 351
            :||.||||:|||:.::||..|||.:.|   |:.|.|||....||||
plant   288 QNGVDYWIVKNSWGKSWGMDGFMHMQRNTENSDGVCGINMLASYPI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 22/61 (36%)
Peptidase_C1A 131..350 CDD:239068 91/222 (41%)
XBCP3NP_563855.1 Inhibitor_I29 32..89 CDD:285458 22/61 (36%)
Peptidase_C1 118..333 CDD:278538 92/224 (41%)
GRAN 351..407 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_137934
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.690

Return to query results.
Submit another query.