DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ALP

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001078774.1 Gene:ALP / 836158 AraportID:AT5G60360 Length:361 Species:Arabidopsis thaliana


Alignment Length:328 Identity:121/328 - (36%)
Similarity:170/328 - (51%) Gaps:54/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VQNFDDFLRQTGKVYSD-EERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEI- 97
            |.:|..|..:.||.|.: ||...|.|||...:.||..:||   .|:| ::||||..||:|.:|. 
plant    56 VLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNK---KGLS-YKLGVNQFADLTWQEFQ 116

  Fly    98 -----------ATLLGS-KISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGV 150
                       |||.|| |::|                    |.|||..||||.|.|:|...|| 
plant   117 RTKLGAAQNCSATLKGSHKVTE--------------------AALPETKDWREDGIVSPVKDQG- 160

  Fly   151 GCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDH-GVTL 214
            |||:||:|:||||||....:..|...|||:|.|||||..:.|.||:||.....||||:.: |:..
plant   161 GCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDT 225

  Fly   215 ANKYPYTQTEMQCR-QNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTIS 278
            ...||||..:..|: ..|..|       |::.:...||.|.|:::|..:..:.|::.:... ..|
plant   226 EKAYPYTGKDETCKFSAENVG-------VQVLNSVNITLGAEDELKHAVGLVRPVSIAFEV-IHS 282

  Fly   279 FEQYSGGIYEDEECNQG--ELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGF--MRILRN-AG 338
            |..|..|:|.|..|...  ::||:|..||||.|:|..||:||||:..:||:.|:  |.:.:| .|
plant   283 FRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCG 347

  Fly   339 GFC 341
            .:|
plant   348 KYC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 24/59 (41%)
Peptidase_C1A 131..350 CDD:239068 86/218 (39%)
ALPNP_001078774.1 Inhibitor_I29 59..115 CDD:285458 24/59 (41%)
Peptidase_C1 141..347 CDD:278538 85/214 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.