DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and XCP1

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_567983.1 Gene:XCP1 / 829688 AraportID:AT4G35350 Length:355 Species:Arabidopsis thaliana


Alignment Length:342 Identity:123/342 - (35%)
Similarity:181/342 - (52%) Gaps:44/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QQLQSFPKLCDVQNFDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVN 87
            :.|.:..||.::  |:.::.:..|.| |.||:|:|..:|  :.:|:.:..:|  |.::.:.||:|
plant    39 EHLTNTDKLLEL--FESWMSEHSKAYKSVEEKVHRFEVF--RENLMHIDQRN--NEINSYWLGLN 97

  Fly    88 TLADMTRKEIATLLGSKISEFGERYTN-GHINFVTARNPASAN--------LPEMFDWREKGGVT 143
            ..||:|.:           ||..||.. ....|...|.| |||        ||:..|||:||.|.
plant    98 EFADLTHE-----------EFKGRYLGLAKPQFSRKRQP-SANFRYRDITDLPKSVDWRKKGAVA 150

  Fly   144 PPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEY-I 207
            |...|| .||:||:|:|..|:||.....||.|:|||:|.|:|| |...|.||:||..:|.|:| |
plant   151 PVKDQG-QCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDC-DTTFNSGCNGGLMDYAFQYII 213

  Fly   208 RDHGVTLANKYPYTQTEMQCR-QNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACS 271
            ...|:...:.|||...|..|: |.|...|      |.|..|..:...|:|.:.:.:|. .|::.:
plant   214 STGGLHKEDDYPYLMEEGICQEQKEDVER------VTISGYEDVPENDDESLVKALAH-QPVSVA 271

  Fly   272 MNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRN 336
            :.|....|:.|.||:: :.:|.. :|:|.|..||||:..|.||.|:|||:...|||.||:|:.||
plant   272 IEASGRDFQFYKGGVF-NGKCGT-DLDHGVAAVGYGSSKGSDYVIVKNSWGPRWGEKGFIRMKRN 334

  Fly   337 AG---GFCGIASECSYP 350
            .|   |.|||....|||
plant   335 TGKPEGLCGINKMASYP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/59 (31%)
Peptidase_C1A 131..350 CDD:239068 89/223 (40%)
XCP1NP_567983.1 Inhibitor_I29 51..106 CDD:214853 18/69 (26%)
Peptidase_C1 137..352 CDD:395062 92/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.