DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT4G23520

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_567686.2 Gene:AT4G23520 / 828452 AraportID:AT4G23520 Length:356 Species:Arabidopsis thaliana


Alignment Length:327 Identity:109/327 - (33%)
Similarity:172/327 - (52%) Gaps:37/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVYS----DEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIA 98
            |..::.:.||.|:    ::||.::.    .|.:|..:...||.|  ..::||:...||:|.:|..
plant    47 FQMWMSKHGKTYTNALGEKERRFQN----FKDNLRFIDQHNAKN--LSYQLGLTRFADLTVQEYR 105

  Fly    99 TLL-GSKISEFGERYTNGHINFVTARN--P-ASANLPEMFDWREKGGVTPPGFQGVGCGACWSFA 159
            .|. ||...:  :|      |..|:|.  | |...|||..|||::|.|:....||. |.:||:|:
plant   106 DLFPGSPKPK--QR------NLKTSRRYVPLAGDQLPESVDWRQEGAVSEIKDQGT-CNSCWAFS 161

  Fly   160 TTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDG-GFQEYGFEY-IRDHGVTLANKYPYTQ 222
            |..|:||.....||.|.|||:|.||||  :..|.||.| |..:..|:: |.::|:.....|||..
plant   162 TVAAVEGLNKIVTGELISLSEQELVDC--NLVNNGCYGSGLMDTAFQFLINNNGLDSEKDYPYQG 224

  Fly   223 TEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIY 287
            |:..|.:.::..    ..::.|..|..:...||..:::.:|. .|::..::..:..|..|...||
plant   225 TQGSCNRKQSTS----NKVITIDSYEDVPANDEISLQKAVAH-QPVSVGVDKKSQEFMLYRSCIY 284

  Fly   288 EDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRN---AGGFCGIASECSY 349
             :..|.. .|:|::.:||||:|||:||||::||:...||:.|:::|.||   ..|.||||...||
plant   285 -NGPCGT-NLDHALVIVGYGSENGQDYWIVRNSWGTTWGDAGYIKIARNFEDPKGLCGIAMLASY 347

  Fly   350 PI 351
            ||
plant   348 PI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/62 (26%)
Peptidase_C1A 131..350 CDD:239068 79/223 (35%)
AT4G23520NP_567686.2 Inhibitor_I29 47..103 CDD:214853 16/61 (26%)
Peptidase_C1 133..349 CDD:278538 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.