DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT4G11320

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001328659.1 Gene:AT4G11320 / 826734 AraportID:AT4G11320 Length:371 Species:Arabidopsis thaliana


Alignment Length:331 Identity:121/331 - (36%)
Similarity:177/331 - (53%) Gaps:44/331 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL 101
            |:.::.:.|||| |..|:..|.:||...:..||  |:||:|  ..:|||:|..||::        
plant    56 FESWMVKHGKVYDSVAEKERRLTIFEDNLRFIT--NRNAEN--LSYRLGLNRFADLS-------- 108

  Fly   102 GSKISEFGE-------RYTNGHINFVTARNPASAN----LPEMFDWREKGGVTPPGFQGVGCGAC 155
               :.|:||       |....|: |:|:.|....:    ||:..|||.:|.||....||: |.:|
plant   109 ---LHEYGEICHGADPRPPRNHV-FMTSSNRYKTSDGDVLPKSVDWRNEGAVTEVKDQGL-CRSC 168

  Fly   156 WSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDH-GVTLANKYP 219
            |:|:|.||:||.....||.|.:||:|:|::|..:  |.||.||..|..:|:|.:: |:...|.||
plant   169 WAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKE--NNGCGGGKVETAYEFIMNNGGLGTDNDYP 231

  Fly   220 YTQTEMQCRQNETAGRPPRESL-VKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYS 283
            |......|.     ||...::. |.|..|..:...||..:.:.:|. .|:...:::.:..|:.|.
plant   232 YKALNGVCE-----GRLKEDNKNVMIDGYENLPANDEAALMKAVAH-QPVTAVVDSSSREFQLYE 290

  Fly   284 GGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAG---GFCGIAS 345
            .|:: |..|.. .|||.|.||||||||||||||:|||....|||.|:|::.||..   |.||||.
plant   291 SGVF-DGTCGT-NLNHGVVVVGYGTENGRDYWIVKNSRGDTWGEAGYMKMARNIANPRGLCGIAM 353

  Fly   346 ECSYPI 351
            ..|||:
plant   354 RASYPL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 22/59 (37%)
Peptidase_C1A 131..350 CDD:239068 88/223 (39%)
AT4G11320NP_001328659.1 Inhibitor_I29 56..111 CDD:214853 22/69 (32%)
Peptidase_C1 144..359 CDD:278538 90/225 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.