DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT3G45310

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_566880.1 Gene:AT3G45310 / 823669 AraportID:AT3G45310 Length:358 Species:Arabidopsis thaliana


Alignment Length:336 Identity:116/336 - (34%)
Similarity:169/336 - (50%) Gaps:52/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VQNFDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEI- 97
            |.:|..|..:.||.| |.||...|.|:|...:.||..:||   .|:| ::|.:|..||:|.:|. 
plant    56 VLSFSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNK---KGLS-YKLSLNQFADLTWQEFQ 116

  Fly    98 -----------ATLLGS-KISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGV 150
                       |||.|| ||:|                    |.:|:..||||.|.|:|...|| 
plant   117 RYKLGAAQNCSATLKGSHKITE--------------------ATVPDTKDWREDGIVSPVKEQG- 160

  Fly   151 GCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIR-DHGVTL 214
            .||:||:|:||||||....:..|...|||:|.|||||..:.|.||.||.....||||: :.|:..
plant   161 HCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEYIKYNGGLDT 225

  Fly   215 ANKYPYTQTEMQCR-QNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTIS 278
            ...||||..:..|: ..:..|       |::||...||.|.|:::|..:..:.|::.:... ...
plant   226 EEAYPYTGKDGGCKFSAKNIG-------VQVRDSVNITLGAEDELKHAVGLVRPVSVAFEV-VHE 282

  Fly   279 FEQYSGGIYEDEECNQG--ELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFC 341
            |..|..|::....|...  ::||:|..||||.|:...||:||||:...||:.|:.: :......|
plant   283 FRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFK-MEMGKNMC 346

  Fly   342 GIASECSYPIL 352
            |:|:..|||::
plant   347 GVATCSSYPVV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 22/59 (37%)
Peptidase_C1A 131..350 CDD:239068 81/222 (36%)
AT3G45310NP_566880.1 Inhibitor_I29 59..115 CDD:285458 22/59 (37%)
Peptidase_C1 141..356 CDD:278538 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.