DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT3G19400

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:365 Identity:117/365 - (32%)
Similarity:180/365 - (49%) Gaps:53/365 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STMWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYS---DEERVYRESIFAAKMS 66
            |.:.|..:||:|.  ...:::.::..:|.    ::.:|.:..|.|:   ::||  |..||...:.
plant    17 SVLLLSSSLGVAT--ETEIERNETEVRLM----YEQWLVENRKNYNGLGEKER--RFKIFKDNLK 73

  Fly    67 LITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL------GSKISEFGER--YTNGHINFVTAR 123
            .:...|...|.   .|.:|:...||:|.:|...:.      .:|.|...||  |..|.:      
plant    74 FVDEHNSVPDR---TFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTERYLYKEGDV------ 129

  Fly   124 NPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCAD 188
                  ||:..|||..|.|.....|| .||:||:|:..||:||.....||.|.|||:|.||||..
plant   130 ------LPDEVDWRANGAVVSVKDQG-NCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDR 187

  Fly   189 DYGNMGCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEM-QC---RQNETAGRPPRESLVKIRDYA 248
            .:.|.|||||...|.||:| ::.|:.....|||...:: .|   :.|.|       .:|.|..|.
plant   188 GFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLCNADKNNNT-------RVVTIDGYE 245

  Fly   249 TITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTENGRD 313
            .:...||:.:|:.:|. .|::.::.|.:.:|:.|..|:... .|.. .|:|.|.|||||:.:|.|
plant   246 DVPRDDEKSLKKAVAH-QPVSVAIEASSQAFQLYKSGVMTG-TCGI-SLDHGVVVVGYGSTSGED 307

  Fly   314 YWIIKNSYSQNWGEGGFMRILRNAG---GFCGIASECSYP 350
            ||||:||:..|||:.|::::.||..   |.||||...|||
plant   308 YWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/61 (25%)
Peptidase_C1A 131..350 CDD:239068 86/226 (38%)
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 15/60 (25%)
Peptidase_C1 130..348 CDD:395062 89/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.