DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and AT2G22160

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_179806.1 Gene:AT2G22160 / 816750 AraportID:AT2G22160 Length:105 Species:Arabidopsis thaliana


Alignment Length:106 Identity:26/106 - (24%)
Similarity:36/106 - (33%) Gaps:34/106 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTA-- 122
            :|......|..:||..    ..::|.:|..|::|..|               :.|.|..|..:  
plant    17 VFKKNAEYIVKTNKER----KPYKLKLNKFANLTDVE---------------FVNAHTCFDMSDH 62

  Fly   123 -----------RNPASANLPEMFDWREKGGVTPPGFQGVGC 152
                       .|...|  |:..||||||.||....||..|
plant    63 KKILDSKPFFYENMTQA--PDSLDWREKGAVTNVKDQGPTC 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 8/36 (22%)
Peptidase_C1A 131..350 CDD:239068 12/22 (55%)
AT2G22160NP_179806.1 Inhibitor_I29 <15..50 CDD:304561 9/51 (18%)
Peptidase_C1 79..>98 CDD:304901 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.