powered by:
Protein Alignment CG6347 and si:dkey-183k8.2
DIOPT Version :9
Sequence 1: | NP_610906.1 |
Gene: | CG6347 / 36531 |
FlyBaseID: | FBgn0033874 |
Length: | 352 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021327519.1 |
Gene: | si:dkey-183k8.2 / 798821 |
ZFINID: | ZDB-GENE-131125-40 |
Length: | 202 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 34/64 - (53%) |
Gaps: | 9/64 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 DDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLG 102
:.|.||. .|::|...||::|....|.:..:|: .|:: :.:|:|..|| :||:..:.|
Zfish 132 EKFNRQN---ESEKEHEKRENLFLHTFSFVHSNNR---AGLT-YSVGINHFAD--KKELTRMTG 186
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275401at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.