DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctso

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038959660.1 Gene:Ctso / 684529 RGDID:1589156 Length:311 Species:Rattus norvegicus


Alignment Length:298 Identity:85/298 - (28%)
Similarity:140/298 - (46%) Gaps:30/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATL-LGSKISEFGERYTNG 115
            |....|||:...:.    |::...||..:.:  |||..:.:..:|...| |||| ..:..||.  
  Rat    31 EAAALRESLNRHRY----LNSFPHDNSTAFY--GVNQFSYLFPEEFKALYLGSK-PAWAPRYP-- 86

  Fly   116 HINFVTARNP-ASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLS 179
                ...:.| .:.:||..||||:|..|.....|.. ||.||:|:...|:|.....:...|..||
  Rat    87 ----AKGQTPIPNVSLPLRFDWRDKHVVNHVRNQKT-CGGCWAFSVVSAVESAGAIQGKPLDYLS 146

  Fly   180 QQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLA--NKYPYTQTEMQCRQNETAGRPPRESLV 242
            .|.::||:  :.|.||.||.......::.:..:.|.  ::||:......||.     .||.:|.|
  Rat   147 VQQVIDCS--FNNYGCRGGSPLGALSWLNETQLKLVADSQYPFKAENGLCRY-----FPPSQSGV 204

  Fly   243 KIRDYATIT-PGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGY 306
            .::.::... ...|::|...:.:.|||.  :..|.:|::.|.|||.: ..|:.||.||:|.:.|:
  Rat   205 SVKGFSAYDFSNQEDEMARALLSFGPLV--VIVDAVSWQDYLGGIIQ-HHCSSGEANHAVLITGF 266

  Fly   307 GTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIA 344
            .......||:::||:..:||..|:..: :..|..||||
  Rat   267 DKTGNTPYWMVRNSWGNSWGVEGYAYV-KMGGNVCGIA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 10/44 (23%)
Peptidase_C1A 131..350 CDD:239068 65/217 (30%)
CtsoXP_038959660.1 Peptidase_C1A 99..304 CDD:239068 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.