DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsb

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:386 Identity:97/386 - (25%)
Similarity:146/386 - (37%) Gaps:108/386 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ||..:.....||...|.....||..|.     ||.:....|                       .
  Rat     1 MWWSLIPLSCLLALTSAHDKPSFHPLS-----DDMINYINK-----------------------Q 37

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLLGS-KISE---FGERYTNGHINFVTARNPASANLPE 132
            |.....|.:.:.:.::.|    :|...|:||. |:.|   |.|                ..||||
  Rat    38 NTTWQAGRNFYNVDISYL----KKLCGTVLGGPKLPERVGFSE----------------DINLPE 82

  Fly   133 MFDWREKGGVTPP----GFQGVGCGACWSFATTGALEGHLFRRTG--VLASLSQQNLVDCADDYG 191
            .||.||:....|.    ..|| .||:||:|....|:...:...|.  |...:|.::|:.|.....
  Rat    83 SFDAREQWSNCPTIAQIRDQG-SCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQC 146

  Fly   192 NMGCDGGFQEYGFEYIRDHGVTLANKY-------PYTQTEMQCRQNETAGRPP------------ 237
            ..||:||:....:.:....|:.....|       |||..  .|..:....|||            
  Rat   147 GDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIP--PCEHHVNGSRPPCTGEGDTPKCNK 209

  Fly   238 ----------RESLVKIRDYATITPGDEEKMKEVIATL---GPLACSMNADTI--SFEQYSGGIY 287
                      :|.  |...|.:.:..|.|  ||::|.:   ||:.   .|.|:  .|..|..|:|
  Rat   210 MCEAGYSTSYKED--KHYGYTSYSVSDSE--KEIMAEIYKNGPVE---GAFTVFSDFLTYKSGVY 267

  Fly   288 EDEECNQGEL--NHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASE 346
            :.|   .|::  .|::.::|:|.|||..||::.||::.:||:.||.:|||.. ..|||.||
  Rat   268 KHE---AGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGE-NHCGIESE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 7/58 (12%)
Peptidase_C1A 131..350 CDD:239068 73/258 (28%)
CtsbNP_072119.2 Propeptide_C1 26..65 CDD:285358 10/70 (14%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.