DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsm

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001347650.1 Gene:Ctsm / 64139 MGIID:1927229 Length:333 Species:Mus musculus


Alignment Length:363 Identity:117/363 - (32%)
Similarity:180/363 - (49%) Gaps:47/363 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQM-TLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMS 66
            |.|.::|.| .||:||.....       ..:.||: :..:..:.||.||.||...:.:::...|.
Mouse     1 MTSAIFLAMLCLGMALPSPAP-------DPILDVE-WQKWKIKYGKAYSLEEEGQKRAVWEDNMK 57

  Fly    67 LITLSNKNADNGVSGFRLGVNTLADMTRKE---------IATLLGSKISEFGERYTNGHINFVTA 122
            .|.|.|.....|..||.:.:|...|||.:|         :.|:...|                :.
Mouse    58 KIKLHNGENGLGKHGFTMEMNAFGDMTLEEFRKVMIEIPVPTVKKGK----------------SV 106

  Fly   123 RNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCA 187
            :...|.|||:..:|:::|.|||...|| .|.:||:|:.|||:||.:||:||.|..||.||||||:
Mouse   107 QKRLSVNLPKFINWKKRGYVTPVQTQG-RCNSCWAFSVTGAIEGQMFRKTGQLIPLSVQNLVDCS 170

  Fly   188 DDYGNMGCDGGFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATIT 251
            ...||.||..|.......|:.:: |:.....|||.:.:..||.:      |..|...|..:..: 
Mouse   171 RPQGNWGCYLGNTYLALHYVMENGGLESEATYPYEEKDGSCRYS------PENSTANITGFEFV- 228

  Fly   252 PGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYG----TENGR 312
            |.:|:.:...:|::||::.:::|...||..|..|||.:..|:...:.||:.:||||    ..:||
Mouse   229 PKNEDALMNAVASIGPISVAIDARHASFLFYKRGIYYEPNCSSSVVTHSMLLVGYGFTGRESDGR 293

  Fly   313 DYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP 350
            .||::|||....||..|:|:|.|:.|..||||:...||
Mouse   294 KYWLVKNSMGTQWGNKGYMKISRDKGNHCGIATYALYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/67 (27%)
Peptidase_C1A 131..350 CDD:239068 82/223 (37%)
CtsmNP_001347650.1 Inhibitor_I29 29..87 CDD:214853 17/57 (30%)
Peptidase_C1A 115..331 CDD:239068 82/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.