DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and zgc:123103

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001032197.2 Gene:zgc:123103 / 641325 ZFINID:ZDB-GENE-051030-105 Length:313 Species:Danio rerio


Alignment Length:66 Identity:18/66 - (27%)
Similarity:36/66 - (54%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL 101
            |..|..:..:.| |::|...||::|......:..:|:   .|:: :.:|:|..||.|::|:|.:.
Zfish   241 FGPFKEKFNRQYESEKEHEERENLFLHTFRFVHSNNR---AGLT-YSVGINHFADKTKEELARMT 301

  Fly   102 G 102
            |
Zfish   302 G 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/59 (25%)
Peptidase_C1A 131..350 CDD:239068
zgc:123103NP_001032197.2 Inhibitor_I29 241..296 CDD:214853 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.