DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and zgc:174153

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001104662.1 Gene:zgc:174153 / 567623 ZFINID:ZDB-GENE-080215-7 Length:336 Species:Danio rerio


Alignment Length:347 Identity:118/347 - (34%)
Similarity:195/347 - (56%) Gaps:24/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALLGAVSLQQLQSFPKLCDVQ---NFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADN 77
            ||:..:.:..:.:.|.: |:|   :::.:..|.||.|.::..|.|..|:...:..|...|.....
Zfish     4 ALIITLCISAVFTAPSI-DIQLDDHWNSWKSQHGKSYHEDVEVGRRMIWEENLRKIEQHNFEYSY 67

  Fly    78 GVSGFRLGVNTLADMTRKEIATLL-GSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGG 141
            |...|::|:|...|||.:|....: |.|...  .|.:.|.: |:   .|:....|:..|||::|.
Zfish    68 GNHTFKMGMNQFGDMTNEEFRQAMNGYKHDP--NRTSQGPL-FM---EPSFFAAPQQVDWRQRGY 126

  Fly   142 VTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEY 206
            |||...| ..||:||||::||||||.|||:||.|.|:|:||||||:...||.||:||..:..|:|
Zfish   127 VTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDLAFQY 190

  Fly   207 IRDH-GVTLANKYPY-TQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLA 269
            :::: |:.....||| .:.::.||.:      ||.::.|...:..|..|:|..:...:|.:||::
Zfish   191 VKENKGLDSEQSYPYLARDDLPCRYD------PRFNVAKSTGFVDIPSGNEPALMNAVAAVGPVS 249

  Fly   270 CSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTEN----GRDYWIIKNSYSQNWGEGGF 330
            .:::|...|.:.|..|||.:..|:...|:|:|.|||||.:.    |..|||:|||:|..||:.|:
Zfish   250 VAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGY 314

  Fly   331 MRILRNAGGFCGIASECSYPIL 352
            :.:.::....||:|::.|||::
Zfish   315 IYMAKDKNNHCGVATKASYPLM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 88/224 (39%)
zgc:174153NP_001104662.1 Inhibitor_I29 28..86 CDD:214853 16/57 (28%)
Peptidase_C1 115..335 CDD:278538 89/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.