DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsf

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001071036.1 Gene:ctsf / 565588 ZFINID:ZDB-GENE-030131-9831 Length:473 Species:Danio rerio


Alignment Length:333 Identity:102/333 - (30%)
Similarity:171/333 - (51%) Gaps:53/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVYSDEE------RVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKE 96
            |.:|:....:.||.:|      |::::::..|: :|.:|...:|:.|::.|       :|:|.  
Zfish   175 FKNFMITYNRTYSSQEEAEKRLRIFQQNMKTAQ-TLQSLEQGSAEYGITKF-------SDLTE-- 229

  Fly    97 IATLLGSKISEFGERYTNGHINFVTARN------PASANLPEMFDWREKGGVTPPGFQGVGCGAC 155
                     .||...|.|..::..:.:.      ||||..|:.:|||:.|.|:|...||: ||:|
Zfish   230 ---------DEFRMMYLNPMLSQWSLKKEMKPAIPASAPAPDTWDWRDHGAVSPVKNQGM-CGSC 284

  Fly   156 WSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRD-HGVTLANKYP 219
            |:|:.||.:||..|::||.|.|||:|.||||  |..:..|.||.....:|.|.: .|:.....|.
Zfish   285 WAFSVTGNIEGQWFKKTGQLLSLSEQELVDC--DKLDQACGGGLPSNAYEAIENLGGLETETDYS 347

  Fly   220 YTQTEMQCRQNETAGRPPRESLVKIRDYATIT---PGDEEKMKEVIATLGPLACSMNADTISFEQ 281
            ||..:..|  :.:.|        |:..|...:   |.||:::...:|..||::.::||..:.|  
Zfish   348 YTGHKQSC--DFSTG--------KVAAYINSSVELPKDEKEIAAFLAENGPVSAALNAFAMQF-- 400

  Fly   282 YSGGIYEDEE--CNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIA 344
            |..|:....:  ||...::|:|.:||:|..||..:|.||||:.:::||.|:..:.|.: |.|||.
Zfish   401 YRKGVSHPLKIFCNPWMIDHAVLLVGFGQRNGVPFWAIKNSWGEDYGEQGYYYLYRGS-GLCGIH 464

  Fly   345 SECSYPIL 352
            ..||..|:
Zfish   465 KMCSSAIV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 14/64 (22%)
Peptidase_C1A 131..350 CDD:239068 79/224 (35%)
ctsfNP_001071036.1 CY 34..144 CDD:214484
PTZ00203 143..472 CDD:185513 101/331 (31%)
Inhibitor_I29 175..231 CDD:214853 14/74 (19%)
Peptidase_C1 262..471 CDD:278538 78/224 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.