powered by:
Protein Alignment CG6347 and si:dkey-228a15.1
DIOPT Version :9
Sequence 1: | NP_610906.1 |
Gene: | CG6347 / 36531 |
FlyBaseID: | FBgn0033874 |
Length: | 352 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017207744.1 |
Gene: | si:dkey-228a15.1 / 564472 |
ZFINID: | ZDB-GENE-060503-344 |
Length: | 313 |
Species: | Danio rerio |
Alignment Length: | 60 |
Identity: | 19/60 - (31%) |
Similarity: | 29/60 - (48%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKE 96
|..|..:..:.| |:||...||..|......:..:|: .|:| |.:|:|..||.:|.|
Zfish 248 FGPFKEKFNRQYKSEEEHQEREINFVQSFRFVNSTNR---KGLS-FTVGINKRADWSRAE 303
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6347 | NP_610906.1 |
Inhibitor_I29 |
38..97 |
CDD:285458 |
19/60 (32%) |
Peptidase_C1A |
131..350 |
CDD:239068 |
|
si:dkey-228a15.1 | XP_017207744.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275401at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.