DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and si:dkey-26g8.5

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001096585.1 Gene:si:dkey-26g8.5 / 563390 ZFINID:ZDB-GENE-121214-19 Length:335 Species:Danio rerio


Alignment Length:347 Identity:121/347 - (34%)
Similarity:194/347 - (55%) Gaps:25/347 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALLGAVSLQQLQSFPKLCDVQ---NFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADN 77
            |||..:.:..:.:.|.: |:|   :::.:..|.||.|.::..|.|..|:...:..|...|.....
Zfish     4 ALLVTLCISAVFTAPSI-DIQLDDHWNSWKSQHGKSYHEDLEVGRRMIWEENLRKIEQHNFEYSY 67

  Fly    78 GVSGFRLGVNTLADMTRKEIATLL-GSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGG 141
            |...|::|:|...|||.:|....: |.|...  .|.:.|.: |:   .|:....|:..|||::|.
Zfish    68 GNHTFKMGMNQFGDMTNEEFRQAMNGYKHDP--NRTSQGPL-FM---EPSFFAAPQQVDWRQRGY 126

  Fly   142 VTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEY 206
            |||...| ..||:||||::||||||.|||:||.|.|:|:||||||:...||.||:||..:..|:|
Zfish   127 VTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGIMDQAFQY 190

  Fly   207 IRDH-GVTLANKYPY-TQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLA 269
            :::: |:.....||| .:.::.||.:      ||.::.||..:..|..|:|..:...:|.:||::
Zfish   191 VKENKGLDSEQSYPYLARDDLPCRYD------PRFNVAKITGFVDIPRGNELALMNAVAAVGPVS 249

  Fly   270 CSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTEN----GRDYWIIKNSYSQNWGEGGF 330
            .:::|...|.:.|..|||.:..|. ..|:|:|.|||||.:.    |..|||:|||:|..||:.|:
Zfish   250 VAIDASHQSLQFYQSGIYYERACT-SRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGY 313

  Fly   331 MRILRNAGGFCGIASECSYPIL 352
            :.:.::....||||:..|||::
Zfish   314 IYMAKDKNNHCGIATMASYPLM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 90/224 (40%)
si:dkey-26g8.5NP_001096585.1 Inhibitor_I29 28..86 CDD:214853 16/57 (28%)
Peptidase_C1 115..334 CDD:278538 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.