DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsll3

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006253592.1 Gene:Ctsll3 / 498691 RGDID:1560071 Length:330 Species:Rattus norvegicus


Alignment Length:355 Identity:125/355 - (35%)
Similarity:199/355 - (56%) Gaps:37/355 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ::|..||.|.::.|..... .||..:     ::::..:.||.|:..|...:.:::...|.:|.|.
  Rat     4 IFLLATLCLGMISAAPTHD-PSFDTV-----WEEWKTKHGKTYNTNEEGQKRAVWENNMKMINLH 62

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLL----GSK---ISEFGERYTNGHINFVTARNPASAN 129
            |::...|..||.|.:|...|:|..|...|:    |.|   :..|.|              |...:
  Rat    63 NEDYLKGKHGFSLEMNAFGDLTNTEFRELMTGFQGQKTKMMKVFPE--------------PFLGD 113

  Fly   130 LPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMG 194
            :|:..|||:.|.|||...|| .||:||:|:..|:|||.:||:||.|..||:||||||:..:||.|
  Rat   114 VPKTVDWRKHGYVTPVKNQG-PCGSCWAFSAVGSLEGQVFRKTGKLVPLSEQNLVDCSWSHGNKG 177

  Fly   195 CDGGFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKM 258
            ||||..::.|:|::|: |:..:..|||......||.|      |:.|..|:..:.:|.|.:...|
  Rat   178 CDGGLPDFAFQYVKDNGGLDTSVSYPYEALNGTCRYN------PKYSAAKVVGFMSIPPSENALM 236

  Fly   259 KEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE-NGRDYWIIKNSYS 322
            | .:||:||::..::....||:.|.||:|.:.:|:...|||:|.|||||.| :||.||::|||:.
  Rat   237 K-AVATVGPISVGIDIKHKSFQFYKGGMYYEPDCSSTNLNHAVLVVGYGEESDGRKYWLVKNSWG 300

  Fly   323 QNWGEGGFMRILRNAGGFCGIASECSYPIL 352
            ::||..|::::.::....|||||:.||||:
  Rat   301 RDWGMDGYIKMAKDWNNNCGIASDASYPIV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/58 (26%)
Peptidase_C1A 131..350 CDD:239068 93/220 (42%)
Ctsll3XP_006253592.1 Inhibitor_I29 29..87 CDD:214853 15/57 (26%)
Peptidase_C1 114..329 CDD:278538 94/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.