DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsz

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:255 Identity:80/255 - (31%)
Similarity:123/255 - (48%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LPEMFDWREKGGVT---------PPGFQGVGCGACWSFATTGALEGHL-FRRTGVLAS--LSQQN 182
            ||:.:|||...||.         .|.:    ||:||:..:|.||...: .:|.....|  ||.||
Zfish    54 LPKEWDWRNIKGVNYVSTTRNQHIPQY----CGSCWAHGSTSALADRINIKRKAAWPSAYLSVQN 114

  Fly   183 LVDCADDYGNMG-CDGGFQEYGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGR---------PP 237
            ::||    |:.| |.||.....:||..:.|:.......|...:..|:.....|.         ..
Zfish   115 VIDC----GDAGSCSGGDHSGVWEYAHNKGIPDETCNNYQAKDQDCKPFNQCGTCTTFGVCNIVK 175

  Fly   238 RESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVT 302
            ..:|.|:.||.:.:..|  |||..|.:.||::|.:.| |...:.|:||:| .|...:..:||.|:
Zfish   176 NFTLWKVGDYGSASGLD--KMKAEIYSGGPISCGIMA-TDKLDAYTGGLY-SEYVQEPYINHIVS 236

  Fly   303 VVGYGT-ENGRDYWIIKNSYSQNWGEGGFMRILRNA--GGF-----CGIASECSY--PIL 352
            |.|:|. |||.::|:::||:.:.|||.|::||:.:|  ||.     ..|..:|.|  |||
Zfish   237 VAGWGVDENGVEFWVVRNSWGEPWGEKGWLRIVTSAYKGGSGSQYNLAIEEDCMYGDPIL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 76/250 (30%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.