DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctss

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001005695.1 Gene:ctss / 448203 XenbaseID:XB-GENE-953011 Length:333 Species:Xenopus tropicalis


Alignment Length:308 Identity:119/308 - (38%)
Similarity:175/308 - (56%) Gaps:16/308 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KVYSDE-ERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEI-ATLLGSKISEFG 109
            |.|.|| |.:.|...:...::|:.:.|.....|:..:.||:|.|||||.:|| :.|.|..:....
 Frog    36 KDYEDEIEDLQRRITWEKNLNLVNMHNLEYSMGMHTYELGMNHLADMTSEEIKSKLTGLILPPQS 100

  Fly   110 ERYTNGHINFVTARNPA-SANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTG 173
            ||    ...|.:.:|.. ...:|:..|||:||.|:....|| |||:||:|:..|||||.|..:||
 Frog   101 ER----QATFSSQKNSTFGGKVPDSIDWRDKGCVSDVKNQG-GCGSCWAFSAVGALEGQLMLKTG 160

  Fly   174 VLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPP 237
            .|.|||.||||||:..|||.||.|||....|:|:.|: |:...:.|||...:.:|..:.|.   .
 Frog   161 KLVSLSPQNLVDCSSKYGNKGCGGGFMTQAFQYVIDNKGIDSDSYYPYHAMDEKCHYDPTG---K 222

  Fly   238 RESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVT 302
            ..:..|   |..|.||.|:.:|:.:.::||::.:::....||..|..|:|.|..|:. |:||.|.
 Frog   223 ASTCAK---YTEIVPGTEDNLKQALGSIGPISVAIDGTRPSFFLYRSGVYSDPTCSH-EVNHGVL 283

  Fly   303 VVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP 350
            .||||..||:|:|::|||:...:|:.|::||.||.|..||:||...||
 Frog   284 AVGYGNLNGQDFWLLKNSWGTKYGDQGYVRIARNKGNLCGVASYTCYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 17/50 (34%)
Peptidase_C1A 131..350 CDD:239068 92/219 (42%)
ctssNP_001005695.1 Inhibitor_I29 27..87 CDD:369782 17/50 (34%)
Peptidase_C1A 119..331 CDD:239068 92/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.