DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsql2

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001002813.2 Gene:Ctsql2 / 408201 RGDID:1303225 Length:343 Species:Rattus norvegicus


Alignment Length:361 Identity:121/361 - (33%)
Similarity:186/361 - (51%) Gaps:37/361 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTLGLAL----LGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ||..|.|    ||.||  ...:|....||| :.::..:..|:||.||.:.:..::...:..|.|.
  Rat     1 MTAALFLIILCLGVVS--GASAFNLSLDVQ-WQEWKMKYEKLYSPEEELLKRVVWEENVKKIELH 62

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLL-GSKISEFGERYTNGHINFVTARNPASA------- 128
            |:....|.:.:.:.:|..||:|.:|...:: |..:.      .|..:..:..|...|.       
  Rat    63 NRENSLGKNTYIMEINNFADLTDEEFKDMITGITLP------INNTMKSLWKRALGSPFPNSWYW 121

  Fly   129 --NLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYG 191
              .||:..|||::|.||....|| .|.:||:|...||:||.:|::||.|..||.||||||:...|
  Rat   122 RDALPKSIDWRKEGYVTRVREQG-KCKSCWAFPVAGAIEGQMFKKTGKLTPLSVQNLVDCSKPQG 185

  Fly   192 NMGCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDE 255
            |.||.||.....|:|: ::.|:.....|||...|..|:.|      |:.:..||..:..: |.||
  Rat   186 NKGCRGGTTYNAFQYVLQNGGLESEATYPYKGKEGLCKYN------PKNAYAKITRFVAL-PEDE 243

  Fly   256 EKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWI 316
            :.:.:.:||.||:|..::....|...|..|||.:.:|| ..:||:|.|||||.|    :|.:||:
  Rat   244 DVLMDALATKGPVAAGIHVVYSSLRFYKKGIYHEPKCN-NRVNHAVLVVGYGFEGNETDGNNYWL 307

  Fly   317 IKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPIL 352
            ||||:.:.||..|:|:|.::....||||:...|||:
  Rat   308 IKNSWGKQWGLKGYMKIAKDRNNHCGIATFAQYPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 13/58 (22%)
Peptidase_C1A 131..350 CDD:239068 87/223 (39%)
Ctsql2NP_001002813.2 Inhibitor_I29 29..87 CDD:214853 13/57 (23%)
Peptidase_C1 125..342 CDD:278538 89/225 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.