DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsc

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012812143.2 Gene:ctsc / 407938 XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis


Alignment Length:238 Identity:76/238 - (31%)
Similarity:116/238 - (48%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LPEMFDWREKGG---VTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLAS--LSQQNLVDCADD 189
            ||..:|||...|   |||...| ..||:|::|::.|.||..:..|:.:...  ||.|.:|.|: :
 Frog   226 LPTEWDWRNIAGYNFVTPVRNQ-ASCGSCYAFSSMGMLESRIQIRSQLSQKPILSPQQVVSCS-N 288

  Fly   190 YGNMGCDGGFQE-YGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYAT---- 249
            | :.||:|||.. ...:|:.|:|:...:..|||.::..|...::.           :.|.|    
 Frog   289 Y-SQGCEGGFPYLIAGKYVSDYGIVEESDLPYTGSDSPCTLKDSQ-----------QKYYTAEYH 341

  Fly   250 ITPG-----DEEKMKEVIATLGPLACSMNADTISFEQYSGGIYE----DEECNQGEL-NHSVTVV 304
            ...|     :|..||..:...|||:.:..... .|..|..|:|.    .::.|..:| ||:|.:|
 Frog   342 YVGGFYGGCNEAYMKLELVLGGPLSVAFEVYD-DFMHYRSGVYHHTGLQDKFNPFQLTNHAVLLV 405

  Fly   305 GYGT--ENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIAS 345
            ||||  :.|..|||:|||:.::|||.|:.||.|.... |.|.|
 Frog   406 GYGTDQQTGEKYWIVKNSWGESWGEKGYFRIRRGTDE-CAIES 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 75/237 (32%)
ctscXP_012812143.2 CathepsinC_exc 20..136 CDD:400909
Peptidase_C1A_CathepsinC 226..455 CDD:239112 76/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.