DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsba

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_998501.1 Gene:ctsba / 406645 ZFINID:ZDB-GENE-040426-2650 Length:330 Species:Danio rerio


Alignment Length:274 Identity:72/274 - (26%)
Similarity:112/274 - (40%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RYTNGHINFVTARNPASANLPEMFDWREKGGVTPP----GFQGVGCGACWSFATTGALEGH--LF 169
            :||.|            ..||:.||.||:....|.    ..|| .||:||:|....|:...  :.
Zfish    72 QYTEG------------LKLPKNFDAREQWPNCPTLKEIRDQG-SCGSCWAFGAAEAISDRVCIH 123

  Fly   170 RRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLANKY-------PYTQTEMQC 227
            ....|...:|.|:|:.|.|..| |||:||:....:::....|:.....|       |||..  .|
Zfish   124 SDAKVSVEISSQDLLTCCDSCG-MGCNGGYPSAAWDFWATEGLVTGGLYNSHIGCRPYTIE--PC 185

  Fly   228 RQNETAGRPP-------------------RESLVKIRDYATITPGDEEKMKEVIATL---GPLAC 270
            ..:....|||                   ..|..:.:.:...:.........::|.|   ||:. 
Zfish   186 EHHVNGSRPPCSGEGGDTPNCDMKCEPGYSPSYKQDKHFGKTSYSVPSNQNSIMAELFKNGPVE- 249

  Fly   271 SMNADTI--SFEQYSGGIYEDEECNQ-GELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMR 332
              .|.|:  .|..|..|:|:....:. |  .|::.::|:|.|||..||:..||::.:||:.|:.:
Zfish   250 --GAFTVYEDFLLYKSGVYQHMSGSPVG--GHAIKILGWGEENGVPYWLAANSWNTDWGDNGYFK 310

  Fly   333 ILRNAGGFCGIASE 346
            |||.. ..|||.||
Zfish   311 ILRGE-DHCGIESE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 68/254 (27%)
ctsbaNP_998501.1 Propeptide_C1 25..64 CDD:285358
Peptidase_C1A_CathepsinB 80..327 CDD:239111 68/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.