DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CG12163

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster


Alignment Length:335 Identity:108/335 - (32%)
Similarity:163/335 - (48%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL 101
            |..|..:.|:.| |..||..|..||  :.:|.|:...|| |.:...:.|:...||||.       
  Fly   308 FYKFQVRFGRRYVSTAERQMRLRIF--RQNLKTIEELNA-NEMGSAKYGITEFADMTS------- 362

  Fly   102 GSKISEFGER----------YTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACW 156
                ||:.||          .|.|....|.|.:   ..||:.||||:|..||....|| .||:||
  Fly   363 ----SEYKERTGLWQRDEAKATGGSAAVVPAYH---GELPKEFDWRQKDAVTQVKNQG-SCGSCW 419

  Fly   157 SFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRD-HGVTLANKYPY 220
            :|:.||.:||....:||.|...|:|.|:||  |..:..|:||..:..::.|:| .|:....:|||
  Fly   420 AFSVTGNIEGLYAVKTGELKEFSEQELLDC--DTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPY 482

  Fly   221 TQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGG 285
            ...:.||..|.|.      |.|::..:..:..|:|..|:|.:...||::..:||:.:.|  |.||
  Fly   483 KAKKNQCHFNRTL------SHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF--YRGG 539

  Fly   286 IYEDEE--CNQGELNHSVTVVGYGTENGRD------YWIIKNSYSQNWGEGGFMRILRNAGGFCG 342
            :....:  |::..|:|.|.|||||..:..:      |||:|||:...|||.|:.|:.| ....||
  Fly   540 VSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYR-GDNTCG 603

  Fly   343 IASECSYPIL 352
            ::...:..:|
  Fly   604 VSEMATSAVL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 20/59 (34%)
Peptidase_C1A 131..350 CDD:239068 78/227 (34%)
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 21/70 (30%)
Peptidase_C1A 395..611 CDD:239068 78/227 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.